spectrumoutagemap.net— independent community tracker, not affiliated with Charter Spectrum™.Official support:833-949-0036

Spectrum outage Reno — live status

Real-time Spectrum outage map for Reno, Nevada. See user reports by neighborhood and ZIP code, learn what's causing the current issue, and get quick fixes for Spectrum internet, TV, and voice service.

ALL SYSTEMS NORMAL

Spectrum is running normally

0 reports in the last 30 minutes.

0
Reports (Last 30 Min)
Steady
Current Trend
0
Reports Today
2
This Month
0
Cities Affected (48h)
Help Your Neighbors
Submit a Report

Outage Timeline · Local Hours

Waiting for enough upstream data points to draw an hourly trend

0 reports · 24h
Not enough live data yet

The upstream feed hasn't returned enough hourly points to plot a real 24-hour trend for this view. Rather than draw a misleading line, we'll wait for genuine reports to arrive — the chart updates automatically every 30 seconds.

Issue Breakdown

Waiting for real reports to classify service impact

No categorised reports yet

The upstream feed hasn't returned a service breakdown for this scope. This panel will populate as soon as real reports arrive.

Live U.S. Outage Heat Map

State intensity from real reports in the last 48 hours

LowHigh
WAORCANVIDMTWYUTAZCONMNDSDNEKSOKTXMNIAMOARLAWIILMSMIINKYTNALOHGAFLSCNCVAWVPANYVTNHMEMARICTNJDEMDDCHIAK
Current hot states
1NY
63
2FL
60
3NC
60
4OH
41
5CA
29

Latest Reports

Most recent community submissions nationwide

LIVE
  • Reno NV[89519]
    Internet
  • Reno NV[89509]
    Internet

Most Affected Cities

Ranked by report volume (48h) · click for live status

LIVE

Reno ZIP heatmap

Live report intensity by ZIP · 0 of 5 ZIPs active · 0 reports in 48h

LowHigh
895010no reports
895020no reports
895030no reports
895090no reports
895110no reports

No outage reports across Reno ZIPs in the last 48 hours — Spectrum service appears stable.

Outage alerts

Get notified when ZIP 89501 spikes

Real-time browser push + email when reports surge in the last 15 minutes.

Push not supported in this browser.

Email confirmations activate once our sender domain is verified. Push works right away.

Is Spectrum down in Reno right now?

The console above updates every 60 seconds with fresh reports from Spectrum customers across the Reno metro. If report volume in the last 30 minutes is above 5, something is very likely wrong on Spectrum's network in your part of the city. If it's zero and only your service is out, the issue is probably on your side — start with a modem reboot.

Neighborhoods most affected

  • Downtown
  • North
  • South
  • East
  • West

Popular Reno ZIP codes

  • 89501
  • 89502
  • 89503
  • 89509
  • 89511

What to do right now in Reno

  1. Check the live map above. If reports are spiking, sit tight — it's not you.
  2. Reboot your modem. Only if the map is quiet. Unplug for 60 seconds, plug back in, wait 2–3 minutes.
  3. Run a speed test. Our real speed test confirms whether your connection is degraded even if it's technically online.
  4. Report your outage below. Your report helps neighbors know it's not just them.
  5. Document the outage. Note the start time — you'll need it to request a bill credit later.

Local outage context — Reno, Nevada

Spectrum's Reno footprint is dominated by long trench-buried plant across master-planned Las Vegas suburbs, which means the first place Reno outages show up on this map is usually where an amplifier or node sits behind a NV Energy feeder. Locally, the most common outage trigger is high-desert wind and 115°F heat on cabinets — particularly during June–September — followed by construction fiber cuts along major surface streets. The ZIP with the heaviest historical report volume in Reno is 89501, followed by 89502.

Get a bill credit for this outage

If your Spectrum service in Reno is down for more than a couple of hours, you may be eligible for a prorated bill credit. Call 833-949-0036 and reference the outage duration and your service address.

See the credit request walkthrough →

Report an outage in Reno

Adding your report helps every other Spectrum customer in Reno know they're not alone. Reports are reviewed by our team before appearing on the live console.

Report a Reno outage →

Frequently asked questions

Is Spectrum down in Reno right now?

The live console at the top of this page shows real-time Spectrum outage reports for Reno. A green "All systems normal" badge means we're seeing no user reports in the last 30 minutes. Amber means a handful of Reno customers are reporting problems — usually a neighborhood-level issue. Red means major outage activity is affecting large parts of the Reno metro.

Which Reno neighborhoods are usually hit hardest?

The neighborhoods with the highest report volume during Reno Spectrum outages historically include Downtown, North, South — dense areas where a single node failure can knock thousands of subscribers offline at once. Weather-related outages spread more evenly across the metro.

How do I get a bill credit after a Spectrum outage in Reno?

Call Spectrum at 833-949-0036 or open a case in the My Spectrum app. Reference the outage start and end time, your Reno service address, and specifically ask for a prorated service credit. Credits are not automatic — you have to request them. Customers who document the outage duration (screenshots from this page help) typically receive credits within one billing cycle.

Should I reboot my modem before assuming Spectrum is down in Reno?

Only if the live map above shows a low report count. If Reno reports are already spiking, rebooting won't help — the problem is upstream. If the map is quiet and only your service is out, unplug your modem for 60 seconds, plug it back in, and wait 2–3 minutes for it to fully re-sync.

What ZIP codes in Reno does this tracker cover?

We track community reports across every Reno ZIP Spectrum serves, including 89501, 89502, 89503, 89509, 89511. If you don't see your ZIP explicitly, it's still counted in the city-wide report volume.

What usually causes Spectrum outages in Reno?

The recurring drivers we track for Reno are high-desert wind and 115°F heat on cabinets (worst during June–September), NV Energy power events that knock amplifiers offline until utility grid power returns, and buried-fiber cuts from utility locates or road work.

Which local Reno utility affects Spectrum uptime the most?

NV Energy feeds most of the Spectrum plant that serves Reno. When a large utility outage hits, Spectrum amplifiers on that same grid segment go dark until utility power is restored — even though Spectrum's core network is fine.

What time of year does Reno see the most Spectrum outages?

June–September is peak outage season in Reno because high-desert wind and 115°F heat on cabinets generate the most simultaneous reports. Off-season outages tend to be more isolated — a single amplifier or a fiber cut — and clear faster.

How fast are Spectrum outages usually resolved in Reno?

Most Reno outages we track resolve within 45–90 minutes when it's a node or amplifier issue. Utility-driven outages resolve as soon as NV Energy restores grid power. Fiber cuts stretch to 4–8 hours depending on the splice location.

Community reports & discussion — Reno

0 approved

Comments are moderated before appearing. No links, no spam. Please be respectful.

Loading comments…

Is Spectrum Down Right Now?

Report it in 15 seconds and let your neighbors know — every report helps.

Related pages for Reno customers

Nearby metros, ZIP-level checks, service-specific outage pages, and troubleshooting guides.