spectrumoutagemap.net— independent community tracker, not affiliated with Charter Spectrum™.Official support:833-949-0036

Spectrum outage Durham — live status

Real-time Spectrum outage map for Durham, North Carolina. See user reports by neighborhood and ZIP code, learn what's causing the current issue, and get quick fixes for Spectrum internet, TV, and voice service.

ALL SYSTEMS NORMAL

Spectrum is running normally

0 reports in the last 30 minutes.

0
Reports (Last 30 Min)
Steady
Current Trend
0
Reports Today
35
This Month
1
Cities Affected (48h)
Help Your Neighbors
Submit a Report

Outage Timeline · Local Hours

Hover, tap, or use ← → keys · spikes indicate widespread failures

peak 10
108642006121823

Issue Breakdown

Share of live reports by service

5 reports
80%
🌐Internet
60%
📺TV
0%
Phone/Voice

Live U.S. Outage Heat Map

State intensity from real reports in the last 48 hours

LowHigh
WAORCANVIDMTWYUTAZCONMNDSDNEKSOKTXMNIAMOARLAWIILMSMIINKYTNALOHGAFLSCNCVAWVPANYVTNHMEMARICTNJDEMDDCHIAK
Current hot states
1NY
63
2FL
60
3NC
60
4OH
41
5CA
29

Latest Reports

Most recent community submissions nationwide

LIVE
  • Durham NC[27704]
    Internet - Generator on Danube street might need gas
  • Durham NC[27705]
    Internet
  • Durham NC[27707]
    Internet+TV
  • Durham NC[27705]
    Internet+TV
  • Durham NC[27713]
    TV
  • Durham NC[27704]
    Internet
  • Durham NC[27712]
    TV
  • Durham NC[27703]
    Internet
  • Durham NC[27705]
    Internet
  • Durham NC[27712]
    TV
  • Durham NC[27703]
    Internet+TV
  • Durham NC[27712]
    Internet
  • Durham NC[27703]
    All - Modem and router showing red lights
  • Durham NC[27703]
    Internet - Been out for almost 24hrs
  • Durham NC[27703]
    Internet
  • Durham NC[27703]
    Internet
  • Durham NC[27703]
    Internet
  • Durham NC[27703]
    All
  • Durham NC[27703]
    All
  • Durham NC[27703]
    Internet
  • Durham NC[27703]
    Internet
  • Durham NC[27703]
    All
  • Durham NC[27703]
    Internet
  • Durham NC[27703]
    Internet
  • Durham NC[27704]
    Internet
  • Durham NC[27703]
    Internet
  • Durham NC[27703]
    Internet
  • Durham NC[27703]
    Internet
  • Durham NC[27705]
    All - router shows blinking red light
  • Durham NC[27705]
    Internet
  • Durham NC[27705]
    TV
  • Durham NC[27704]
    All
  • Durham NC[27705]
    Internet
  • Durham NC[27713]
    Internet
  • Durham NC[27713]
    Internet - modem blinking

Most Affected Cities

Ranked by report volume (48h) · click for live status

LIVE

Durham ZIP heatmap

Live report intensity by ZIP · 4 of 6 ZIPs active · 5 reports in 48h

LowHigh
2770523h ago
2770411h ago
2770714h ago
27713113h ago
277010no reports
277030no reports
Outage alerts

Get notified when ZIP 27701 spikes

Real-time browser push + email when reports surge in the last 15 minutes.

Push not supported in this browser.

Email confirmations activate once our sender domain is verified. Push works right away.

Is Spectrum down in Durham right now?

The console above updates every 60 seconds with fresh reports from Spectrum customers across the Durham metro. If report volume in the last 30 minutes is above 5, something is very likely wrong on Spectrum's network in your part of the city. If it's zero and only your service is out, the issue is probably on your side — start with a modem reboot.

Neighborhoods most affected

  • Downtown
  • North
  • South
  • East
  • West

Popular Durham ZIP codes

  • 27701
  • 27703
  • 27705
  • 27707
  • 27713

What to do right now in Durham

  1. Check the live map above. If reports are spiking, sit tight — it's not you.
  2. Reboot your modem. Only if the map is quiet. Unplug for 60 seconds, plug back in, wait 2–3 minutes.
  3. Run a speed test. Our real speed test confirms whether your connection is degraded even if it's technically online.
  4. Report your outage below. Your report helps neighbors know it's not just them.
  5. Document the outage. Note the start time — you'll need it to request a bill credit later.

Local outage context — Durham, North Carolina

Spectrum's Durham footprint is dominated by aerial plant on shared poles across the Piedmont, which means the first place Durham outages show up on this map is usually where an amplifier or node sits behind a Duke Energy Carolinas feeder. Locally, the most common outage trigger is hurricanes on the coast and ice storms in the Piedmont — particularly during August–October — followed by construction fiber cuts along major surface streets. The ZIP with the heaviest historical report volume in Durham is 27701, followed by 27703.

Get a bill credit for this outage

If your Spectrum service in Durham is down for more than a couple of hours, you may be eligible for a prorated bill credit. Call 833-949-0036 and reference the outage duration and your service address.

See the credit request walkthrough →

Report an outage in Durham

Adding your report helps every other Spectrum customer in Durham know they're not alone. Reports are reviewed by our team before appearing on the live console.

Report a Durham outage →

Frequently asked questions

Is Spectrum down in Durham right now?

The live console at the top of this page shows real-time Spectrum outage reports for Durham. A green "All systems normal" badge means we're seeing no user reports in the last 30 minutes. Amber means a handful of Durham customers are reporting problems — usually a neighborhood-level issue. Red means major outage activity is affecting large parts of the Durham metro.

Which Durham neighborhoods are usually hit hardest?

The neighborhoods with the highest report volume during Durham Spectrum outages historically include Downtown, North, South — dense areas where a single node failure can knock thousands of subscribers offline at once. Weather-related outages spread more evenly across the metro.

How do I get a bill credit after a Spectrum outage in Durham?

Call Spectrum at 833-949-0036 or open a case in the My Spectrum app. Reference the outage start and end time, your Durham service address, and specifically ask for a prorated service credit. Credits are not automatic — you have to request them. Customers who document the outage duration (screenshots from this page help) typically receive credits within one billing cycle.

Should I reboot my modem before assuming Spectrum is down in Durham?

Only if the live map above shows a low report count. If Durham reports are already spiking, rebooting won't help — the problem is upstream. If the map is quiet and only your service is out, unplug your modem for 60 seconds, plug it back in, and wait 2–3 minutes for it to fully re-sync.

What ZIP codes in Durham does this tracker cover?

We track community reports across every Durham ZIP Spectrum serves, including 27701, 27703, 27705, 27707, 27713. If you don't see your ZIP explicitly, it's still counted in the city-wide report volume.

What usually causes Spectrum outages in Durham?

The recurring drivers we track for Durham are hurricanes on the coast and ice storms in the Piedmont (worst during August–October), Duke Energy Carolinas power events that knock amplifiers offline until utility grid power returns, and buried-fiber cuts from utility locates or road work.

Which local Durham utility affects Spectrum uptime the most?

Duke Energy Carolinas feeds most of the Spectrum plant that serves Durham. When a large utility outage hits, Spectrum amplifiers on that same grid segment go dark until utility power is restored — even though Spectrum's core network is fine.

What time of year does Durham see the most Spectrum outages?

August–October is peak outage season in Durham because hurricanes on the coast and ice storms in the Piedmont generate the most simultaneous reports. Off-season outages tend to be more isolated — a single amplifier or a fiber cut — and clear faster.

Is my Durham address on Spectrum's coax or fiber plant?

The vast majority of Spectrum service in Durham runs on hybrid fiber-coax (HFC). Only a small footprint of Spectrum Internet Gig 2X buildouts run all-fiber. If your modem is an E31, you're on HFC — which is what our outage map is designed to detect.

Community reports & discussion — Durham

0 approved

Comments are moderated before appearing. No links, no spam. Please be respectful.

Loading comments…

Is Spectrum Down Right Now?

Report it in 15 seconds and let your neighbors know — every report helps.

Related pages for Durham customers

Nearby metros, ZIP-level checks, service-specific outage pages, and troubleshooting guides.