spectrumoutagemap.net— independent community tracker, not affiliated with Charter Spectrum™.Official support:833-949-0036

Spectrum outage Manchester — live status

Real-time Spectrum outage map for Manchester, New Hampshire. See user reports by neighborhood and ZIP code, learn what's causing the current issue, and get quick fixes for Spectrum internet, TV, and voice service.

ALL SYSTEMS NORMAL

Spectrum is running normally

0 reports in the last 30 minutes.

0
Reports (Last 30 Min)
Steady
Current Trend
0
Reports Today
0
This Month
0
Cities Affected (48h)
Help Your Neighbors
Submit a Report

Outage Timeline · Local Hours

Waiting for enough upstream data points to draw an hourly trend

0 reports · 24h
Not enough live data yet

The upstream feed hasn't returned enough hourly points to plot a real 24-hour trend for this view. Rather than draw a misleading line, we'll wait for genuine reports to arrive — the chart updates automatically every 30 seconds.

Issue Breakdown

Waiting for real reports to classify service impact

No categorised reports yet

The upstream feed hasn't returned a service breakdown for this scope. This panel will populate as soon as real reports arrive.

Live U.S. Outage Heat Map

State intensity from real reports in the last 48 hours

LowHigh
WAORCANVIDMTWYUTAZCONMNDSDNEKSOKTXMNIAMOARLAWIILMSMIINKYTNALOHGAFLSCNCVAWVPANYVTNHMEMARICTNJDEMDDCHIAK
Current hot states
1NY
65
2NC
60
3FL
57
4OH
38
5CA
27

Latest Reports

Most recent community submissions nationwide

LIVE

    Most Affected Cities

    Ranked by report volume (48h) · click for live status

    LIVE

      Manchester ZIP heatmap

      Live report intensity by ZIP · 0 of 5 ZIPs active · 0 reports in 48h

      LowHigh
      031010no reports
      031020no reports
      031030no reports
      031040no reports
      031090no reports

      No outage reports across Manchester ZIPs in the last 48 hours — Spectrum service appears stable.

      Outage alerts

      Get notified when ZIP 03101 spikes

      Real-time browser push + email when reports surge in the last 15 minutes.

      Push not supported in this browser.

      Email confirmations activate once our sender domain is verified. Push works right away.

      Is Spectrum down in Manchester right now?

      The console above updates every 60 seconds with fresh reports from Spectrum customers across the Manchester metro. If report volume in the last 30 minutes is above 5, something is very likely wrong on Spectrum's network in your part of the city. If it's zero and only your service is out, the issue is probably on your side — start with a modem reboot.

      Neighborhoods most affected

      • Downtown
      • North
      • South
      • East
      • West

      Popular Manchester ZIP codes

      • 03101
      • 03102
      • 03103
      • 03104
      • 03109

      What to do right now in Manchester

      1. Check the live map above. If reports are spiking, sit tight — it's not you.
      2. Reboot your modem. Only if the map is quiet. Unplug for 60 seconds, plug back in, wait 2–3 minutes.
      3. Run a speed test. Our real speed test confirms whether your connection is degraded even if it's technically online.
      4. Report your outage below. Your report helps neighbors know it's not just them.
      5. Document the outage. Note the start time — you'll need it to request a bill credit later.

      Local outage context — Manchester, New Hampshire

      Spectrum's Manchester footprint is dominated by shared-pole aerial plant across the White Mountains, which means the first place Manchester outages show up on this map is usually where an amplifier or node sits behind a Eversource NH feeder. Locally, the most common outage trigger is nor'easters and ice storms — particularly during November–March — followed by construction fiber cuts along major surface streets. The ZIP with the heaviest historical report volume in Manchester is 03101, followed by 03102.

      Get a bill credit for this outage

      If your Spectrum service in Manchester is down for more than a couple of hours, you may be eligible for a prorated bill credit. Call 833-949-0036 and reference the outage duration and your service address.

      See the credit request walkthrough →

      Report an outage in Manchester

      Adding your report helps every other Spectrum customer in Manchester know they're not alone. Reports are reviewed by our team before appearing on the live console.

      Report a Manchester outage →

      Frequently asked questions

      Is Spectrum down in Manchester right now?

      The live console at the top of this page shows real-time Spectrum outage reports for Manchester. A green "All systems normal" badge means we're seeing no user reports in the last 30 minutes. Amber means a handful of Manchester customers are reporting problems — usually a neighborhood-level issue. Red means major outage activity is affecting large parts of the Manchester metro.

      Which Manchester neighborhoods are usually hit hardest?

      The neighborhoods with the highest report volume during Manchester Spectrum outages historically include Downtown, North, South — dense areas where a single node failure can knock thousands of subscribers offline at once. Weather-related outages spread more evenly across the metro.

      How do I get a bill credit after a Spectrum outage in Manchester?

      Call Spectrum at 833-949-0036 or open a case in the My Spectrum app. Reference the outage start and end time, your Manchester service address, and specifically ask for a prorated service credit. Credits are not automatic — you have to request them. Customers who document the outage duration (screenshots from this page help) typically receive credits within one billing cycle.

      Should I reboot my modem before assuming Spectrum is down in Manchester?

      Only if the live map above shows a low report count. If Manchester reports are already spiking, rebooting won't help — the problem is upstream. If the map is quiet and only your service is out, unplug your modem for 60 seconds, plug it back in, and wait 2–3 minutes for it to fully re-sync.

      What ZIP codes in Manchester does this tracker cover?

      We track community reports across every Manchester ZIP Spectrum serves, including 03101, 03102, 03103, 03104, 03109. If you don't see your ZIP explicitly, it's still counted in the city-wide report volume.

      What usually causes Spectrum outages in Manchester?

      The recurring drivers we track for Manchester are nor'easters and ice storms (worst during November–March), Eversource NH power events that knock amplifiers offline until utility grid power returns, and buried-fiber cuts from utility locates or road work.

      Which local Manchester utility affects Spectrum uptime the most?

      Eversource NH feeds most of the Spectrum plant that serves Manchester. When a large utility outage hits, Spectrum amplifiers on that same grid segment go dark until utility power is restored — even though Spectrum's core network is fine.

      What time of year does Manchester see the most Spectrum outages?

      November–March is peak outage season in Manchester because nor'easters and ice storms generate the most simultaneous reports. Off-season outages tend to be more isolated — a single amplifier or a fiber cut — and clear faster.

      Does Spectrum give bill credits for outages in Manchester?

      Yes, but only if you call and request one. Reference the outage duration (screenshots from this page help), your Manchester service address, and your account number. Prorated credits typically post within one billing cycle. Auto-credits are not policy.

      Community reports & discussion — Manchester

      0 approved

      Comments are moderated before appearing. No links, no spam. Please be respectful.

      Loading comments…

      Is Spectrum Down Right Now?

      Report it in 15 seconds and let your neighbors know — every report helps.

      Related pages for Manchester customers

      Nearby metros, ZIP-level checks, service-specific outage pages, and troubleshooting guides.