spectrumoutagemap.net— independent community tracker, not affiliated with Charter Spectrum™.Official support:833-949-0036

Spectrum outage Lafayette — live status

Real-time Spectrum outage map for Lafayette, Louisiana. See user reports by neighborhood and ZIP code, learn what's causing the current issue, and get quick fixes for Spectrum internet, TV, and voice service.

ALL SYSTEMS NORMAL

Spectrum is running normally

0 reports in the last 30 minutes.

0
Reports (Last 30 Min)
Steady
Current Trend
0
Reports Today
0
This Month
0
Cities Affected (48h)
Help Your Neighbors
Submit a Report

Outage Timeline · Local Hours

Waiting for enough upstream data points to draw an hourly trend

0 reports · 24h
Not enough live data yet

The upstream feed hasn't returned enough hourly points to plot a real 24-hour trend for this view. Rather than draw a misleading line, we'll wait for genuine reports to arrive — the chart updates automatically every 30 seconds.

Issue Breakdown

Waiting for real reports to classify service impact

No categorised reports yet

The upstream feed hasn't returned a service breakdown for this scope. This panel will populate as soon as real reports arrive.

Live U.S. Outage Heat Map

State intensity from real reports in the last 48 hours

LowHigh
WAORCANVIDMTWYUTAZCONMNDSDNEKSOKTXMNIAMOARLAWIILMSMIINKYTNALOHGAFLSCNCVAWVPANYVTNHMEMARICTNJDEMDDCHIAK
Current hot states
1NY
155
2WI
146
3FL
90
4NC
87
5TX
63

Latest Reports

Most recent community submissions nationwide

LIVE

    Most Affected Cities

    Ranked by report volume (48h) · click for live status

    LIVE

      Lafayette ZIP heatmap

      Live report intensity by ZIP · 0 of 4 ZIPs active · 0 reports in 48h

      LowHigh
      705010no reports
      705030no reports
      705060no reports
      705080no reports

      No outage reports across Lafayette ZIPs in the last 48 hours — Spectrum service appears stable.

      Live outage alerts

      Get notified when ZIP 70501 spikes

      Instant browser push (and email) when 5+ Spectrum outage reports cluster in your ZIP within 15 minutes. Free, no signup, unsubscribe with one click.

      Push not supported in this browser — use email below.
      Prefer email?

      We never sell your data. Push works instantly. Email delivery starts once our sender domain finishes verification.

      Is Spectrum down in Lafayette right now?

      The console above updates every 60 seconds with fresh reports from Spectrum customers across the Lafayette metro. If report volume in the last 30 minutes is above 5, something is very likely wrong on Spectrum's network in your part of the city. If it's zero and only your service is out, the issue is probably on your side — start with a modem reboot.

      Areas we track in Lafayette

      Spectrum's Lafayette footprint covers Lafayette Parish and breaks down into 12 service areas that tend to fail together, because each one sits behind a shared node or amplifier chain. Reports from any of these areas roll into the live Lafayette count above.

      • Downtown Lafayette
      • Oil Center
      • River Ranch
      • Freetown-Port Rico
      • Saint Streets
      • Broussard
      • Youngsville
      • Scott
      • Carencro
      • Milton
      • Duson
      • UL Lafayette district

      Lafayette ZIP codes covered (9)

      Every ZIP below feeds the Lafayette outage count. If a single ZIP spikes while the rest stay quiet, the fault is almost always one node rather than a metro-wide event — check the ZIP heatmap above to confirm.

      • 70501
      • 70503
      • 70506
      • 70508
      • 70502
      • 70505
      • 70507
      • 70518
      • 70592

      Nearby Spectrum status

      Outages rarely stop at the city line. If Lafayette is down, these markets often show activity within the hour — they share upstream fibre routes and, in many cases, the same utility feeders.

      What to do right now in Lafayette

      1. Check the live map above. If reports are spiking, sit tight — it's not you.
      2. Reboot your modem. Only if the map is quiet. Unplug for 60 seconds, plug back in, wait 2–3 minutes.
      3. Run a speed test. Our real speed test confirms whether your connection is degraded even if it's technically online.
      4. Report your outage below. Your report helps neighbors know it's not just them.
      5. Document the outage. Note the start time — you'll need it to request a bill credit later.

      Local outage context — Lafayette, Louisiana

      Spectrum's Lafayette footprint is dominated by aerial plant vulnerable to storm surge and wind, which means the first place Lafayette outages show up on this map is usually where an amplifier or node sits behind a Entergy Louisiana feeder. Locally, the most common outage trigger is hurricanes and severe thunderstorms — particularly during June–November — followed by construction fiber cuts along major surface streets. The ZIP with the heaviest historical report volume in Lafayette is 70501, followed by 70503.

      Get a bill credit for this outage

      If your Spectrum service in Lafayette is down for more than a couple of hours, you may be eligible for a prorated bill credit. Call 833-949-0036 and reference the outage duration and your service address.

      See the credit request walkthrough →

      Report an outage in Lafayette

      Adding your report helps every other Spectrum customer in Lafayette know they're not alone. Reports are reviewed by our team before appearing on the live console.

      Report a Lafayette outage →

      Step-by-step guide

      How to report a Spectrum outage in Lafayette

      The fastest reporting channels ranked by response time, exactly what to say to the Spectrum agent, the info to have ready, and how to get the outage logged so it counts toward a bill credit.

      Spectrum not working in Lafayette? Troubleshoot it in order

      Work down this table before calling Spectrum. Each row maps a symptom Lafayette customers report to its most likely local cause — Entergy Louisiana grid events, hurricanes and severe thunderstorms, or aerial plant vulnerable to storm surge and wind — and the fix that actually resolves it. If the Lafayette console above is spiking, skip straight to the last two rows: the fault is on Charter's plant, not in your home.

      Symptom in LafayetteMost likely local causeWhat actually fixes it
      No internet at all, modem online light off or blinkingAn amplifier or node upstream of your Lafayette address has dropped, usually after a Entergy Louisiana power event or hurricanes and severe thunderstorms.Check the live Lafayette console above first (start with 70501). If reports are climbing, it is Spectrum's plant — a reboot cannot fix it, so log a report and wait for restoration.
      Internet is connected but nothing loadsPartial upstream loss on the Lafayette segment, or a DNS/CMTS fault at the regional hub.Compare against the map: quiet map in Lafayette means power-cycle the modem for 60 seconds and let it re-sync for 2–3 minutes; busy map means the fault is on Spectrum's side.
      WiFi works, but only some devices lose serviceRouter-side issue local to your home, not a network outage — band steering or a stale DHCP lease.Reboot the router only (not the modem), reconnect on the 5 GHz SSID, then re-test. Lafayette reports staying flat confirms it is inside your home.
      TV or cable box out, internet fineA video-tier fault or channel-lineup change scoped to the Lafayette headend rather than the data plant.Filter the console to TV reports for Lafayette. If TV volume is spiking on its own, the headend is the cause — no equipment reset needed.
      Service drops repeatedly for a few minutes at a timeIntermittent ingress on aerial plant — very common in Lafayette during June–November, when hurricanes and severe thunderstorms flex aerial plant vulnerable to storm surge and wind.Log each drop with timestamps from this page, then request a line technician (not a phone reset) referencing the Lafayette report pattern.
      Whole street is out and utility power is also downEntergy Louisiana grid event — Spectrum amplifiers in Lafayette draw power from the same feeders.Track the Entergy Louisiana restoration estimate; Spectrum service in Lafayette typically returns 5–20 minutes after grid power is back, without any action from you.

      Still down after working through the table? Report the Lafayette outage so neighbors on your node can confirm it, then read how long Spectrum outages last and how to claim a bill credit.

      Frequently asked questions

      Is Spectrum down in Lafayette right now?

      The live console at the top of this page shows real-time Spectrum outage reports for Lafayette. A green "All systems normal" badge means we're seeing no user reports in the last 30 minutes. Amber means a handful of Lafayette customers are reporting problems — usually a neighborhood-level issue. Red means major outage activity is affecting large parts of the Lafayette metro.

      Which Lafayette neighborhoods are usually hit hardest?

      The neighborhoods with the highest report volume during Lafayette Spectrum outages historically include Downtown Lafayette, Oil Center, River Ranch — dense areas where a single node failure can knock thousands of subscribers offline at once. Weather-related outages spread more evenly across the metro.

      How do I get a bill credit after a Spectrum outage in Lafayette?

      Call Spectrum at 833-949-0036 or open a case in the My Spectrum app. Reference the outage start and end time, your Lafayette service address, and specifically ask for a prorated service credit. Credits are not automatic — you have to request them. Customers who document the outage duration (screenshots from this page help) typically receive credits within one billing cycle.

      Should I reboot my modem before assuming Spectrum is down in Lafayette?

      Only if the live map above shows a low report count. If Lafayette reports are already spiking, rebooting won't help — the problem is upstream. If the map is quiet and only your service is out, unplug your modem for 60 seconds, plug it back in, and wait 2–3 minutes for it to fully re-sync.

      What ZIP codes in Lafayette does this tracker cover?

      We track 9 Lafayette ZIP codes, including 70501, 70503, 70506, 70508, 70502, 70505. If you don't see your ZIP explicitly, it's still counted in the city-wide report volume.

      What areas does Spectrum serve in Lafayette?

      Spectrum's Lafayette footprint, across Lafayette Parish, covers Downtown Lafayette, Oil Center, River Ranch, Freetown-Port Rico, Saint Streets, Broussard, Youngsville, Scott, Carencro, Milton, Duson, UL Lafayette district. Each of those areas typically sits behind its own node group, which is why an outage can hit one part of Lafayette while the rest of the metro stays online.

      What usually causes Spectrum outages in Lafayette?

      The recurring drivers we track for Lafayette are hurricanes and severe thunderstorms (worst during June–November), Entergy Louisiana power events that knock amplifiers offline until utility grid power returns, and buried-fiber cuts from utility locates or road work.

      Which local Lafayette utility affects Spectrum uptime the most?

      Entergy Louisiana feeds most of the Spectrum plant that serves Lafayette. When a large utility outage hits, Spectrum amplifiers on that same grid segment go dark until utility power is restored — even though Spectrum's core network is fine.

      What time of year does Lafayette see the most Spectrum outages?

      June–November is peak outage season in Lafayette because hurricanes and severe thunderstorms generate the most simultaneous reports. Off-season outages tend to be more isolated — a single amplifier or a fiber cut — and clear faster.

      Does Spectrum give bill credits for outages in Lafayette?

      Yes, but only if you call and request one. Reference the outage duration (screenshots from this page help), your Lafayette service address, and your account number. Prorated credits typically post within one billing cycle. Auto-credits are not policy.

      Why is my Spectrum internet not working in Lafayette but my neighbor's is fine?

      Spectrum's Lafayette plant splits customers across many downstream nodes, so two homes on the same street can sit behind different amplifiers. If the Lafayette console shows only a handful of reports, you are almost certainly on a faulted tap or drop line — request a line technician rather than a phone-based reset.

      How do I fix Spectrum WiFi problems in Lafayette myself?

      Only after ruling out the network: confirm the Lafayette map is quiet, then power-cycle the modem for 60 seconds, wait 2–3 minutes for it to re-sync, reboot the router separately, and re-test on the 5 GHz band. If Lafayette reports are rising instead, the fault is upstream on Charter's plant and nothing in your home will change it.

      Does bad weather in Lafayette cause Spectrum outages?

      Yes — hurricanes and severe thunderstorms is the single biggest driver here, concentrated in June–November. Lafayette's plant relies on aerial plant vulnerable to storm surge and wind, so wind, ice or heat stress on those spans is what turns a local weather event into a Spectrum outage.

      Who do I call about a Spectrum outage in Lafayette?

      Spectrum support is 833-949-0036. Before calling, note the outage start time from this page and your Lafayette service address — that is what agents need to open a ticket and, for longer outages, approve a prorated bill credit.

      Which Lafayette ZIP codes report Spectrum outages most often?

      70501, 70503, 70506, 70508 carry the heaviest historical report volume in Lafayette. Enter your own ZIP on the console above to see whether the current activity is on your node or elsewhere in Louisiana.

      How long will a Spectrum outage in Lafayette last?

      Node and amplifier faults in Lafayette typically clear in 45–90 minutes. Entergy Louisiana power events clear as soon as grid power is restored. Fiber cuts from Lafayette road work run 4–8 hours depending on the splice location.

      Community reports & discussion — Lafayette

      Comments are moderated before appearing. No links, no spam. Please be respectful.

      Be the first to share what you're seeing.

      Is Spectrum Down Right Now?

      Report it in 15 seconds and let your neighbors know — every report helps.

      Related pages for Lafayette customers

      Nearby metros, ZIP-level checks, service-specific outage pages, and troubleshooting guides.