spectrumoutagemap.net— independent community tracker, not affiliated with Charter Spectrum™.Official support:833-949-0036

Spectrum outage Rhode Island — live map

Real-time Spectrum outage tracker for every Rhode Island city Spectrum serves. Check statewide report volume, then drill into your metro for neighborhood-level detail. Roughly 310K+ Spectrum subscribers across Rhode Island.

ALL SYSTEMS NORMAL

Spectrum is running normally

0 reports in the last 30 minutes.

0
Reports (Last 30 Min)
Steady
Current Trend
0
Reports Today
0
This Month
0
Cities Affected (48h)
Help Your Neighbors
Submit a Report

Outage Timeline · Local Hours

Waiting for enough upstream data points to draw an hourly trend

0 reports · 24h
Not enough live data yet

The upstream feed hasn't returned enough hourly points to plot a real 24-hour trend for this view. Rather than draw a misleading line, we'll wait for genuine reports to arrive — the chart updates automatically every 30 seconds.

Issue Breakdown

Waiting for real reports to classify service impact

No categorised reports yet

The upstream feed hasn't returned a service breakdown for this scope. This panel will populate as soon as real reports arrive.

Live U.S. Outage Heat Map

State intensity from real reports in the last 48 hours

LowHigh
WAORCANVIDMTWYUTAZCONMNDSDNEKSOKTXMNIAMOARLAWIILMSMIINKYTNALOHGAFLSCNCVAWVPANYVTNHMEMARICTNJDEMDDCHIAK
Current hot states
1FL
81
2NY
67
3NC
63
4OH
45
5CA
34

Latest Reports

Most recent community submissions nationwide

LIVE

    Most Affected Cities

    Ranked by report volume (48h) · click for live status

    LIVE
      Outage alerts

      Get notified when your area spikes

      Real-time browser push + email when reports surge in the last 15 minutes.

      Push not supported in this browser.

      Email confirmations activate once our sender domain is verified. Push works right away.

      Charter Spectrum is one of the largest residential ISPs in Rhode Island, with a footprint spanning Providence Metro, South County. When something goes wrong on Spectrum's network here, it usually shows up on this page within minutes because reports come in from every corner of the state simultaneously.

      Common causes of Spectrum outages in Rhode Island

      Every state has its own outage-cause profile. In Rhode Island, the most common recurring drivers we see are severe weather events that damage aerial coax lines across Providence Metro, planned overnight node maintenance in older cable segments, backbone fiber cuts caused by construction crews, and utility power events that take amplifiers offline until grid power returns. Regional backbone failures typically show up as a simultaneous spike across multiple Rhode Island metros — that's what the statewide console above catches first.

      What to do during a Rhode Island Spectrum outage

      1. Check the live console above — statewide report volume tells you if this is a multi-city event.
      2. Drill into your specific city page for neighborhood-level detail.
      3. If the map is quiet in your area, try a modem reboot before assuming it's Spectrum.
      4. Document the outage start time in case you request a bill credit later.
      5. Submit a report so other Rhode Island customers know it's not just them.

      Rhode Island outage landscape — what actually causes them

      Statewide Spectrum uptime in Rhode Island is driven mainly by nor'easters — the November–March window is when regional outage events tend to cluster. Charter's Rhode Island plant leans on shared-pole aerial plant across dense Providence suburbs, so Rhode Island Energy grid events routinely show up as simultaneous Spectrum outages across Providence, Warwick, Cranston. When you see a statewide spike on the console above, it's almost always either a backbone fiber event or a Rhode Island Energy-driven power event moving across the Providence Metro.

      Major Rhode Island border states

      Rhode Island city pages:

      Outage tools:

      Related pages for Rhode Island customers:

      FAQ — Spectrum outage Rhode Island

      Is Spectrum down in Rhode Island right now?

      The live console above shows real-time Spectrum outage reports aggregated across every Rhode Island metro Spectrum serves. A report volume above 15 in the last 30 minutes typically means a multi-city event affecting a Charter regional backbone.

      What areas does Spectrum serve in Rhode Island?

      Charter Spectrum's Rhode Island footprint covers Providence Metro, South County, with the largest customer bases in Providence, Warwick, Cranston. Some rural pockets are served by fiber overbuilders or fixed wireless instead — pick your city page for a ZIP-level view.

      How long do Spectrum outages last in Rhode Island?

      Most Rhode Island Spectrum outages we track resolve within 30–90 minutes when the cause is a node or amplifier issue. Weather-driven aerial-line events and backbone fiber cuts can stretch to 3–6 hours. The live map above shows the current active window.

      How do I report a Spectrum outage in Rhode Island?

      Use the Report Outage button on the live console, or call Spectrum at 833-949-0036. Reporting on this site helps other Rhode Island customers see they're not alone and improves the accuracy of the statewide map.

      What should I do if Spectrum is down in Rhode Island?

      First, check the live map for your area. If reports are clustered nearby, it's a network event — wait it out or switch to mobile data. If your area is quiet, reboot the modem (unplug 60s, plug back in). Document the outage window for a potential bill credit.

      Which Rhode Island areas have the most Spectrum coverage tracked here?

      We track every ZIP code Spectrum operates in across Rhode Island. The heaviest reporting activity comes from Providence, Warwick, Cranston — simply because those metros have the most subscribers on Spectrum.

      Which Rhode Island cities have the most Spectrum outages?

      The largest report volumes historically come from Providence, Warwick, Cranston, simply because those metros have the most Spectrum subscribers. Per-capita, older coax segments in older neighborhoods tend to see more frequent smaller outages than newer buildouts.

      Does Spectrum serve all of Rhode Island?

      No. Charter Spectrum inherited a patchwork of former Time Warner Cable, Bright House, and legacy Charter footprints across Rhode Island. Some corners of the state are primarily served by other ISPs.

      How do I get a bill credit for a Rhode Island Spectrum outage?

      Call 833-949-0036 or use the My Spectrum app. Reference your service address and the outage window (screenshots from this site help), and specifically request a prorated service credit. Credits are typically applied within one billing cycle and are not automatic.

      Where can I see the outage map for my specific Rhode Island city?

      Pick your city from the list below — each city page has a scoped live console showing reports and affected neighborhoods for that metro only.

      Which weather events cause the most Spectrum outages in Rhode Island?

      Nor'easters are the dominant outage trigger in Rhode Island, concentrated in November–March. Off-season events in Rhode Island tend to be smaller — isolated node or amplifier failures rather than region-wide outages.

      Does Rhode Island Energy power affect Spectrum service in Rhode Island?

      Yes. Spectrum amplifiers across Rhode Island are powered from the local utility grid, so a large Rhode Island Energy outage automatically becomes a Spectrum outage in the same footprint until utility power is restored — even though the Spectrum core network is fine.

      Where in Rhode Island does Charter Spectrum have the most subscribers?

      The heaviest Spectrum subscriber density in Rhode Island is in Providence, Warwick, Cranston. That's also where the fastest response times and node redundancy typically live — smaller Rhode Island markets tend to sit on longer amplifier chains that take longer to fault-isolate.

      Community reports & discussion — Rhode Island

      0 approved

      Comments are moderated before appearing. No links, no spam. Please be respectful.

      Loading comments…