spectrumoutagemap.net— independent community tracker, not affiliated with Charter Spectrum™.Official support:833-949-0036

Spectrum outage Oklahoma — live map

Real-time Spectrum outage tracker for every Oklahoma city Spectrum serves. Check statewide report volume, then drill into your metro for neighborhood-level detail.

ALL SYSTEMS NORMAL

Spectrum is running normally

0 reports in the last 30 minutes.

0
Reports (Last 30 Min)
Steady
Current Trend
0
Reports Today
0
This Month
0
Cities Affected (48h)
Help Your Neighbors
Submit a Report

Outage Timeline · Local Hours

Waiting for enough upstream data points to draw an hourly trend

0 reports · 24h
Not enough live data yet

The upstream feed hasn't returned enough hourly points to plot a real 24-hour trend for this view. Rather than draw a misleading line, we'll wait for genuine reports to arrive — the chart updates automatically every 30 seconds.

Issue Breakdown

Waiting for real reports to classify service impact

No categorised reports yet

The upstream feed hasn't returned a service breakdown for this scope. This panel will populate as soon as real reports arrive.

Live U.S. Outage Heat Map

State intensity from real reports in the last 48 hours

LowHigh
WAORCANVIDMTWYUTAZCONMNDSDNEKSOKTXMNIAMOARLAWIILMSMIINKYTNALOHGAFLSCNCVAWVPANYVTNHMEMARICTNJDEMDDCHIAK
Current hot states
1FL
80
2NY
67
3NC
63
4OH
45
5CA
35

Latest Reports

Most recent community submissions nationwide

LIVE

    Most Affected Cities

    Ranked by report volume (48h) · click for live status

    LIVE
      Outage alerts

      Get notified when your area spikes

      Real-time browser push + email when reports surge in the last 15 minutes.

      Push not supported in this browser.

      Email confirmations activate once our sender domain is verified. Push works right away.

      Charter Spectrum is one of the largest residential ISPs in Oklahoma, with a footprint spanning OKC Metro, Tulsa Metro. When something goes wrong on Spectrum's network here, it usually shows up on this page within minutes because reports come in from every corner of the state simultaneously.

      Common causes of Spectrum outages in Oklahoma

      Every state has its own outage-cause profile. In Oklahoma, the most common recurring drivers we see are severe weather events that damage aerial coax lines across OKC Metro, planned overnight node maintenance in older cable segments, backbone fiber cuts caused by construction crews, and utility power events that take amplifiers offline until grid power returns. Regional backbone failures typically show up as a simultaneous spike across multiple Oklahoma metros — that's what the statewide console above catches first.

      What to do during a Oklahoma Spectrum outage

      1. Check the live console above — statewide report volume tells you if this is a multi-city event.
      2. Drill into your specific city page for neighborhood-level detail.
      3. If the map is quiet in your area, try a modem reboot before assuming it's Spectrum.
      4. Document the outage start time in case you request a bill credit later.
      5. Submit a report so other Oklahoma customers know it's not just them.

      Oklahoma outage landscape — what actually causes them

      Statewide Spectrum uptime in Oklahoma is driven mainly by supercell tornadoes and ice storms — the April–June window is when regional outage events tend to cluster. Charter's Oklahoma plant leans on aerial plant exposed to straight-line wind, so OG&E grid events routinely show up as simultaneous Spectrum outages across Oklahoma City, Tulsa, Norman. When you see a statewide spike on the console above, it's almost always either a backbone fiber event or a OG&E-driven power event moving across the OKC Metro.

      Major Oklahoma border states

      Oklahoma city pages:

      Outage tools:

      Related pages for Oklahoma customers:

      FAQ — Spectrum outage Oklahoma

      Is Spectrum down in Oklahoma right now?

      The live console above shows real-time Spectrum outage reports aggregated across every Oklahoma metro Spectrum serves. A report volume above 15 in the last 30 minutes typically means a multi-city event affecting a Charter regional backbone.

      What areas does Spectrum serve in Oklahoma?

      Charter Spectrum's Oklahoma footprint covers OKC Metro, Tulsa Metro, with the largest customer bases in Oklahoma City, Tulsa, Norman. Some rural pockets are served by fiber overbuilders or fixed wireless instead — pick your city page for a ZIP-level view.

      How long do Spectrum outages last in Oklahoma?

      Most Oklahoma Spectrum outages we track resolve within 30–90 minutes when the cause is a node or amplifier issue. Weather-driven aerial-line events and backbone fiber cuts can stretch to 3–6 hours. The live map above shows the current active window.

      How do I report a Spectrum outage in Oklahoma?

      Use the Report Outage button on the live console, or call Spectrum at 833-949-0036. Reporting on this site helps other Oklahoma customers see they're not alone and improves the accuracy of the statewide map.

      What should I do if Spectrum is down in Oklahoma?

      First, check the live map for your area. If reports are clustered nearby, it's a network event — wait it out or switch to mobile data. If your area is quiet, reboot the modem (unplug 60s, plug back in). Document the outage window for a potential bill credit.

      Which Oklahoma areas have the most Spectrum coverage tracked here?

      We track every ZIP code Spectrum operates in across Oklahoma. The heaviest reporting activity comes from Oklahoma City, Tulsa, Norman — simply because those metros have the most subscribers on Spectrum.

      Which Oklahoma cities have the most Spectrum outages?

      The largest report volumes historically come from Oklahoma City, Tulsa, Norman, simply because those metros have the most Spectrum subscribers. Per-capita, older coax segments in older neighborhoods tend to see more frequent smaller outages than newer buildouts.

      Does Spectrum serve all of Oklahoma?

      No. Charter Spectrum inherited a patchwork of former Time Warner Cable, Bright House, and legacy Charter footprints across Oklahoma. Some corners of the state are primarily served by other ISPs.

      How do I get a bill credit for a Oklahoma Spectrum outage?

      Call 833-949-0036 or use the My Spectrum app. Reference your service address and the outage window (screenshots from this site help), and specifically request a prorated service credit. Credits are typically applied within one billing cycle and are not automatic.

      Where can I see the outage map for my specific Oklahoma city?

      Pick your city from the list below — each city page has a scoped live console showing reports and affected neighborhoods for that metro only.

      Which weather events cause the most Spectrum outages in Oklahoma?

      Supercell tornadoes and ice storms are the dominant outage trigger in Oklahoma, concentrated in April–June. Off-season events in Oklahoma tend to be smaller — isolated node or amplifier failures rather than region-wide outages.

      Does OG&E power affect Spectrum service in Oklahoma?

      Yes. Spectrum amplifiers across Oklahoma are powered from the local utility grid, so a large OG&E outage automatically becomes a Spectrum outage in the same footprint until utility power is restored — even though the Spectrum core network is fine.

      Where in Oklahoma does Charter Spectrum have the most subscribers?

      The heaviest Spectrum subscriber density in Oklahoma is in Oklahoma City, Tulsa, Norman. That's also where the fastest response times and node redundancy typically live — smaller Oklahoma markets tend to sit on longer amplifier chains that take longer to fault-isolate.

      Community reports & discussion — Oklahoma

      0 approved

      Comments are moderated before appearing. No links, no spam. Please be respectful.

      Loading comments…