spectrumoutagemap.net— independent community tracker, not affiliated with Charter Spectrum™.Official support:833-949-0036

Spectrum outage North Dakota — live map

Real-time Spectrum outage tracker for every North Dakota city Spectrum serves. Check statewide report volume, then drill into your metro for neighborhood-level detail.

ALL SYSTEMS NORMAL

Spectrum is running normally

0 reports in the last 30 minutes.

0
Reports (Last 30 Min)
Steady
Current Trend
0
Reports Today
0
This Month
0
Cities Affected (48h)
Help Your Neighbors
Submit a Report

Outage Timeline · Local Hours

Waiting for enough upstream data points to draw an hourly trend

0 reports · 24h
Not enough live data yet

The upstream feed hasn't returned enough hourly points to plot a real 24-hour trend for this view. Rather than draw a misleading line, we'll wait for genuine reports to arrive — the chart updates automatically every 30 seconds.

Issue Breakdown

Waiting for real reports to classify service impact

No categorised reports yet

The upstream feed hasn't returned a service breakdown for this scope. This panel will populate as soon as real reports arrive.

Live U.S. Outage Heat Map

State intensity from real reports in the last 48 hours

LowHigh
WAORCANVIDMTWYUTAZCONMNDSDNEKSOKTXMNIAMOARLAWIILMSMIINKYTNALOHGAFLSCNCVAWVPANYVTNHMEMARICTNJDEMDDCHIAK
Current hot states
1FL
82
2NY
67
3NC
63
4OH
45
5CA
34

Latest Reports

Most recent community submissions nationwide

LIVE

    Most Affected Cities

    Ranked by report volume (48h) · click for live status

    LIVE
      Outage alerts

      Get notified when your area spikes

      Real-time browser push + email when reports surge in the last 15 minutes.

      Push not supported in this browser.

      Email confirmations activate once our sender domain is verified. Push works right away.

      Charter Spectrum is one of the largest residential ISPs in North Dakota, with a footprint spanning Red River Valley, Western ND. When something goes wrong on Spectrum's network here, it usually shows up on this page within minutes because reports come in from every corner of the state simultaneously.

      Common causes of Spectrum outages in North Dakota

      Every state has its own outage-cause profile. In North Dakota, the most common recurring drivers we see are severe weather events that damage aerial coax lines across Red River Valley, planned overnight node maintenance in older cable segments, backbone fiber cuts caused by construction crews, and utility power events that take amplifiers offline until grid power returns. Regional backbone failures typically show up as a simultaneous spike across multiple North Dakota metros — that's what the statewide console above catches first.

      What to do during a North Dakota Spectrum outage

      1. Check the live console above — statewide report volume tells you if this is a multi-city event.
      2. Drill into your specific city page for neighborhood-level detail.
      3. If the map is quiet in your area, try a modem reboot before assuming it's Spectrum.
      4. Document the outage start time in case you request a bill credit later.
      5. Submit a report so other North Dakota customers know it's not just them.

      North Dakota outage landscape — what actually causes them

      Statewide Spectrum uptime in North Dakota is driven mainly by blizzards and ice storms — the November–March window is when regional outage events tend to cluster. Charter's North Dakota plant leans on long rural aerial plant across the Red River Valley, so Xcel Energy grid events routinely show up as simultaneous Spectrum outages across Fargo, Bismarck, Grand Forks. When you see a statewide spike on the console above, it's almost always either a backbone fiber event or a Xcel Energy-driven power event moving across the Red River Valley.

      Major North Dakota border states

      Outage tools:

      Related pages for North Dakota customers:

      FAQ — Spectrum outage North Dakota

      Is Spectrum down in North Dakota right now?

      The live console above shows real-time Spectrum outage reports aggregated across every North Dakota metro Spectrum serves. A report volume above 15 in the last 30 minutes typically means a multi-city event affecting a Charter regional backbone.

      What areas does Spectrum serve in North Dakota?

      Charter Spectrum's North Dakota footprint covers Red River Valley, Western ND, with the largest customer bases in Fargo, Bismarck, Grand Forks. Some rural pockets are served by fiber overbuilders or fixed wireless instead — pick your city page for a ZIP-level view.

      How long do Spectrum outages last in North Dakota?

      Most North Dakota Spectrum outages we track resolve within 30–90 minutes when the cause is a node or amplifier issue. Weather-driven aerial-line events and backbone fiber cuts can stretch to 3–6 hours. The live map above shows the current active window.

      How do I report a Spectrum outage in North Dakota?

      Use the Report Outage button on the live console, or call Spectrum at 833-949-0036. Reporting on this site helps other North Dakota customers see they're not alone and improves the accuracy of the statewide map.

      What should I do if Spectrum is down in North Dakota?

      First, check the live map for your area. If reports are clustered nearby, it's a network event — wait it out or switch to mobile data. If your area is quiet, reboot the modem (unplug 60s, plug back in). Document the outage window for a potential bill credit.

      Which North Dakota areas have the most Spectrum coverage tracked here?

      We track every ZIP code Spectrum operates in across North Dakota. The heaviest reporting activity comes from Fargo, Bismarck, Grand Forks — simply because those metros have the most subscribers on Spectrum.

      Which North Dakota cities have the most Spectrum outages?

      The largest report volumes historically come from Fargo, Bismarck, Grand Forks, simply because those metros have the most Spectrum subscribers. Per-capita, older coax segments in older neighborhoods tend to see more frequent smaller outages than newer buildouts.

      Does Spectrum serve all of North Dakota?

      No. Charter Spectrum inherited a patchwork of former Time Warner Cable, Bright House, and legacy Charter footprints across North Dakota. Some corners of the state are primarily served by other ISPs.

      How do I get a bill credit for a North Dakota Spectrum outage?

      Call 833-949-0036 or use the My Spectrum app. Reference your service address and the outage window (screenshots from this site help), and specifically request a prorated service credit. Credits are typically applied within one billing cycle and are not automatic.

      Where can I see the outage map for my specific North Dakota city?

      Pick your city from the list below — each city page has a scoped live console showing reports and affected neighborhoods for that metro only.

      Which weather events cause the most Spectrum outages in North Dakota?

      Blizzards and ice storms are the dominant outage trigger in North Dakota, concentrated in November–March. Off-season events in North Dakota tend to be smaller — isolated node or amplifier failures rather than region-wide outages.

      Does Xcel Energy power affect Spectrum service in North Dakota?

      Yes. Spectrum amplifiers across North Dakota are powered from the local utility grid, so a large Xcel Energy outage automatically becomes a Spectrum outage in the same footprint until utility power is restored — even though the Spectrum core network is fine.

      Where in North Dakota does Charter Spectrum have the most subscribers?

      The heaviest Spectrum subscriber density in North Dakota is in Fargo, Bismarck, Grand Forks. That's also where the fastest response times and node redundancy typically live — smaller North Dakota markets tend to sit on longer amplifier chains that take longer to fault-isolate.

      Community reports & discussion — North Dakota

      0 approved

      Comments are moderated before appearing. No links, no spam. Please be respectful.

      Loading comments…